WebbShowing subcellular location of PRSS22 (BSSP-4, hBSSP-4, SP001LA). We use cookies to enhance the usability of our website. If you continue, we'll assume that you are happy to … • Clark HF, Gurney AL, Abaya E, et al. (2003). "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment". Genome Res. 13 (10): 2265–70. doi:10.1101/gr.1293003. PMC 403697. PMID 12975309. • Martin J, Han C, Gordon LA, et al. (2004). "The sequence and analysis of duplication-rich human chromosome 16". Nature. 432 (7020): 988–94. Bibcode: • Clark HF, Gurney AL, Abaya E, et al. (2003). "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment". Genome Res. 13 (10): 2265–70. doi:10.1101/gr.1293003. PMC 403697. PMID 12975309. • Martin J, Han C, Gordon LA, et al. (2004). "The sequence and analysis of duplication-rich human chromosome 16". Nature. 432 (7020): 988–94. Bibcode:2004Natur.432..988M. doi:1…
Cell atlas - PRSS22 - The Human Protein Atlas
Webb21 mars 2024 · PRSS22 (Serine Protease 22) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase activity . An … WebbRecombinant protein fragment: Length (aa) 54: Antigen sequence: AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLT SRWV Matching … buzzs water well service
InParanoiDB 9
WebbDomain architecture for Protein. Click on a domain to view its domain ortholog groups. Full-length Protein Ortholog Groups for P05981. Gene name: HPN / HEPS_HUMAN . ... PRSS22: 109: 0.282-Brain-Specific Serine Protease 4: 1900: Homo sapiens: Q9NRR2: TPSG1: 109: 0.24-Tryptase Gamma: 1900: Homo sapiens: Q15661: TPSAB1: 109: 0.225 … WebbExpression of PRSS22 (BSSP-4, hBSSP-4, SP001LA) in cancer tissue. The cancer tissue page shows antibody staining of the protein in 20 different cancers. We use cookies to … WebbPubMed cetme sling mount